Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ Main.10
⌊ FunctionalDomain Cytosolic GST-like protein, similar to chloride channel ("CLIC") proteins (ID 224542)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Ailuropoda melanoleuca Taxon ID: 9646 | 281347655 | EFB23239.1 (Genbank) | URP |
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | D2I6G1 | D2I6G1_AILME (TrEMBL) |
Length of Enzyme (full-length): 229 | Length of Functional Domain: 229
QAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGANPPFLVYNKE
LKTDFIKIEEFLEQTLAPPRYPHLSPKNKESFDVGCNLFAKFSAYIKNTQKEANKNFEKS
LLREFKRLDDYLNTPLLDEIDPDSAEELTVSRRLFLDGDQLTLADCSLLPKLNIIKVAAK
KYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYASVAKQKS
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



