Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup anaerobic coproporphyrinogen-III oxidase like

     ⌊ Family cyclopropanase

  ⌊ FunctionalDomain cyclopropanase (jaw5) (ID 2183584)

Superfamily Assignment Evidence Code(s) ISS PubMed:24756819
Family Assignment Evidence Code CFM PubMed:24756819
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces roseoverticillatus Taxon ID: 66429 651078531

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A060PWX2 A0A060PWX2_9ACTN (TrEMBL)

Sequence

Length of Enzyme (full-length): 478 | Length of Functional Domain: 458

1       10        20        30        40        50        60

MLDSAFVKEYLDTHLEERQVNKVQHGFPSPRYWNELTVPMDEITEDRRRLQKDGRQAGVY
LYIGVPYCIKTTPGKCGYCLFPVEEFRGNDALEDYYGYVEREAELYRERWEGSVLTTAYF
GGGTSNLYRPHMYHKIMDLVRSFFPDISPAADVTLEGIPQLFTRDKMQAIRDSGMNRISM
GVQQVNERLNSLSGRKQTTRHVVQSLEWAREFGLAANVDVIFGWPRQTVETMLEDLETLV
SWEVHDITHYELNVGGPTDFALNRFHELPSTLSNLEMYREARDFLLDRGYEQHGAYSFRK
PGDPTTRLFREGYRPETTRDTSDAVGLGYAAVSFFGDASLGDGRSWSFINQRNLALYKKA
IDEGRFPIERGFRHQPADWLLATLFRKLLSMEIDRAGIRRAMNVDVYEEFATIWDALAER
DLAEIEPDRIRLVGDGPFYTPLVSALLAEERYRALREREAHAKKAGLVLVDDEGAEHG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 2/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
76 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
79 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
68 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
76 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
79 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
68 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:24756819
76 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:24756819
79 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:24756819

Catalyzed Reaction

trans-but-2-enoyl-[ACP] cycloisomerase

+ + +
trans-but-2-enoyl-[ACP]
132146		 S-adenosyl-L-methionine zwitterion
59789		 2-cyclopropane-butyl-[ACP]
132147		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
July 15, 2014, 7 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 454 458
update name uncharacterized Anaerobic coproporphyrinogen-III oxidase subgroup sequence Jaw5
update domain start position 35 1
update superfamily assignment evidence code IEA ISS
Oct. 15, 2016, 7:36 a.m. update curation agent setDomainBoundaries.py holliday
update name Jaw5 cyclopropanase (jaw5)
Oct. 15, 2016, 7:36 a.m. update curation agent holliday setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.