Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup spore photoproduct lyase like

     ⌊ Family spore photoproduct lyase 1

  ⌊ FunctionalDomain Spore photoproduct lyase 1 (ID 2074297)

Superfamily Assignment Evidence Code(s) IEA
Family Assignment Evidence Code IEA
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Geobacillus thermodenitrificans NG80-2 Taxon ID: 420246 395759472 URP
Geobacillus thermodenitrificans NG80-2 Taxon ID: 420246 395759471 URP

Sequence

Length of Enzyme (full-length): 368 | Length of Functional Domain: 342

1       10        20        30        40        50        60

MKHHHHHHPMSDYDIPTTENLYFQGAMGKPFVPKLVYFEPEALSYPLGKELYEKFTQMGI
KIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSSKPSAEYAIPLATGCMGH
CHYCYLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAACTSDIVGIDHLTHS
LKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFD
GRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHR
FTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFP
GAYVQYFT
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
117 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
121 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
124 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 4/4 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
117 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
121 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
124 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
125 Tyr (Y) side chain Hydrogen radical shuttle hydrogen relay -- reactant IEA
Family CAR This EFD conserves 5/5 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
117 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:22761404
121 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:22761404
124 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:22761404
125 Tyr (Y) side chain Hydrogen radical shuttle hydrogen relay -- reactant ISS PubMed:22761404
167 Cys (C) side chain Hydrogen radical shuttle hydrogen relay -- reactant ISS PubMed:22761404

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4FHD Spore Photoproduct Lyase Complexed With Dinucleoside Spore Photoproduct Spore Photoproduct Lyase 5 2.0 Iron/Sulfur Cluster
(4 more ⇓) 		CSA • PDB • PDBSum
4FHC Spore Photoproduct Lyase Spore Photoproduct Lyase 5 2.2 Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
4K9R Spore Photoproduct Lyase Y98F Mutant Spore Photoproduct Lyase 5 2.3 Yes Iron/Sulfur Cluster
(2 more ⇓) 		CSA • PDB • PDBSum
4FHF Spore Photoproduct Lyase C140A Mutant With Dinucleoside Spore Photoproduct Spore Photoproduct Lyase 5 2.3 Yes Iron/Sulfur Cluster
(4 more ⇓) 		CSA • PDB • PDBSum
4FHE Spore Photoproduct Lyase C140A Mutant Spore Photoproduct Lyase 5 2.0 Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
4FHG Spore Photoproduct Lyase C140S Mutant Spore Photoproduct Lyase 5 2.0 Yes Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
4RH1 Spore Photoproduct Lyase C140A/S76C Mutant With Bound Adomet And Dinucleoside Spore Photoproduct Spore Photoproduct Lyase 5 2.6 Yes Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
4RH0 Spore Photoproduct Lyase C140A/S76C Mutant With Bound Adomet Spore Photoproduct Lyase 5 2.1 Yes [(3S)-3-Amino-4-Hydroxy-4-Oxo-Butyl]-[[(2S,3S,4R,5R)-5-(6-Aminopurin-9-Yl)-3,4-Dihydroxy-Oxolan-2-Yl]Methyl]-Methyl-Selanium
(3 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
July 15, 2014, 5:19 a.m. update curation agent updateSuperfamily.py holliday
update curation agent holliday setDomainBoundaries.py
update domain start position 27 1
update domain start position 1 27
EC number assigned by UniProtKB accession ID.