Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

  ⌊ main SPASM domain-containing

  ⌊ cyclic pyranopterin phosphate synthase (MoaA-like)

  ⌊ FunctionalDomain MoaA-like subgroup protein sequence (ID 1927026)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onDec. 10, 2016

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Staphylococcus aureus FVRH6131 Taxon ID: 1409712 580874694 EVI96078.1 (Genbank) URP
Staphylococcus aureus OCMM6071 Taxon ID: 1409604 580671928 EVG95231.1 (Genbank) URP

Sequence

Length of Enzyme (full-length): 147 | Length of Functional Domain: 144

1       10        20        30        40        50        60

MVEQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAK
VYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGL
RRINVSLDAM
IRYFNQSIIVILKRLRF
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
24 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
28 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
31 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 4/7 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
24 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
28 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
31 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
75 Gly (G) side chain Binds S-adensosylmethionine
Notes: Acts via the carbonyl group of the backbone
substrate binding -- binding ISS

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
2FB3 Structure Of Moaa In Complex With 5'-Gtp Molybdenum Cofactor Biosynthesis Protein A 49 2.35 Sulfate Ion
(5 more ⇓)
CSA • PDB • PDBSum
1TV8 Structure Of Moaa In Complex With S-Adenosylmethionine Molybdenum Cofactor Biosynthesis Protein A 49 2.2 Sulfate Ion
(3 more ⇓)
CSA • PDB • PDBSum
1TV7 Structure Of The S-Adenosylmethionine Dependent Enzyme Moaa Molybdenum Cofactor Biosynthesis Protein A 49 2.8 Sulfate Ion • Iron/Sulfur Cluster CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
July 15, 2014, 7:03 a.m. update curation agent updateSuperfamily.py setDomainBoundaries.py
update domain end position 141 142
Oct. 15, 2016, 7:41 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain end position 142 144
update name uncharacterized SPASM/twitch domain containing subgroup sequence MoaA-like subgroup protein sequence
update subgroup SPASM/twitch domain containing cyclic pyranopterin phosphate synthase (MoaA-like)
EC number assigned by UniProtKB accession ID.