Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup mandelate racemase
⌊ FunctionalDomain uncharacterized mandelate racemase subgroup sequence (ID 1860411)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank: obsolete GI = 585301184
Length of Enzyme (full-length): 273 | Length of Functional Domain: 273
MMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPT
HWGPHDGDAGIRKDAAMVADMREKCGEDFWLMLDCWMSQDVNYAIKLAHACAPYNLKWIE
ECLPPQQYEGYRELKHNAPAGMMVTSGEHHGTLQSFRTLSETGIDIMQPDVGWCGGLTTL
VEIAAIAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEP
VPVNGRIHKSVLDKPGFGVELNRDCNLKRPYSH
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



