Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup mandelate racemase
⌊ Family rhamnonate dehydratase
⌊ FunctionalDomain rhamnonate dehydratase (ID 18602)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | Nov. 21, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 486152492 | WP_001518659.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky Taxon ID: 192955 | 808336151 | KKE75634.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky Taxon ID: 192955 | 808297480 | KKE42076.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky Taxon ID: 192955 | 808272241 | KKE17593.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky Taxon ID: 192955 | 808241728 | KKD87634.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cubana str. CFSAN001083 Taxon ID: 1194157 | 554421585 | ESJ47996.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky str. 0253 Taxon ID: 1156551 | 553487190 | ESC11198.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 Taxon ID: 454231 | 205335965 | EDZ22729.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 Taxon ID: 439842 | 194456603 | EDX45442.1 (Genbank) | URP |
| obsolete GIs = 194470239, 168229657 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A1U7FW95 | A0A1U7FW95_SALET (TrEMBL) | |
| n/a | B3YCH0 | B3YCH0_SALET (TrEMBL) |
Length of Enzyme (full-length): 401 | Length of Functional Domain: 401
MTLPKIKHVRAWFIGGATAEKGAGGGDYHDQGGNHWIDDHIATPMSKYRDYEQSRQSFGI
NVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVEKHLNRFIEGKCVSDIKLIHDQMLGATM
YYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDLAKEMG
FIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGPDFWLMLDCWMSQDVNYATKLAHACA
PFNLKWIEECLPPQQYEGYRELKRNAPAGMMVTSGEHHGTLQSFRTLAETGIDIMQPDVG
WCGGLTTLVEIAALAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLMTSPDCSTLRPQF
DPILLDEPVPVNGRIHKSVLDKPGFGVELNRDCRLKRPYSH
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



