Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup mandelate racemase
⌊ Family rhamnonate dehydratase
⌊ FunctionalDomain rhamnonate dehydratase (ID 18601)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | Nov. 21, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 486162808 | WP_001526367.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Typhimurium Taxon ID: 90371 | 808324793 | KKE68753.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Typhimurium Taxon ID: 90371 | 808320872 | KKE64986.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar 4,[5],12:i:- Taxon ID: 440524 | 808319040 | KKE63226.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar 4,[5],12:i:- Taxon ID: 440524 | 808311407 | KKE55737.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar 4,[5],12:i:- Taxon ID: 440524 | 808304212 | KKE48685.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Typhimurium Taxon ID: 90371 | 808290533 | KKE35341.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Typhimurium Taxon ID: 90371 | 808283941 | KKE29008.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Enteritidis Taxon ID: 149539 | 808267153 | KKE12626.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Typhimurium Taxon ID: 90371 | 660591183 | AIE06246.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Typhimurium str. CDC_2009K1153 Taxon ID: 891424 | 444807196 | ELX34914.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 Taxon ID: 440534 | 205329202 | EDZ15966.1 (Genbank) | URP |
| obsolete GI = 167992626 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A0W4I8Y2 | A0A0W4I8Y2_SALCE (TrEMBL) |
Length of Enzyme (full-length): 401 | Length of Functional Domain: 401
MTLPKIKHVRAWFIGGATAEKGAGGGDYHDQGGNHWIDDHIATPMSKYRDYEQSRQSFGI
NVLGTLIVEVEAENRQTGFAVSTAGEMGCFIVETHLNRFIEGKCVSDIKLIHDQMLGATM
YYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDLAKEMG
FIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGPDFWLMLDCWMSQDVNYATKLAHACA
PFNLKWIEECLPPQQYEGYRELKRNAPAGMMVTSGEHHGTLQSFRTLAETGIDIMQPDVG
WCGGLTTLVEIAALAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLMTSPDCSTLRPQF
DPILLDEPVPVNGRIHKSVLDKPGFGVELNRDCHLKRPYSH
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



