Top Level Name

  ⌊ Superfamily (core) Isoprenoid Synthase Type II

    ⌊ Subgroup Prenyltransferase Like 1

  ⌊ FunctionalDomain uncharacterized Prenyltransferase Like 1 subgroup sequence, Isoprenoid Synthase Type II superfamily (ID 149426)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Macaca mulatta Taxon ID: 9544 383872903 NP_001244634.1 (RefSeq) PRP URP
Macaca nemestrina Taxon ID: 9545 795595987 XP_011725961.1 (RefSeq)
Cercocebus torquatus atys Taxon ID: 9531 795566374 XP_011909208.1 (RefSeq)
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a F6XMJ2 F6XMJ2_MACMU (TrEMBL)
n/a A0A0D9RLV8 A0A0D9RLV8_CHLSB (TrEMBL)

Sequence

Length of Enzyme (full-length): 437 | Length of Functional Domain: 369

1       10        20        30        40        50        60

MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFS
SYKFNHLVPRLILQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ
IVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDVINREKLLQY
LYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY
SFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDF
YHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPV
PGFEELKDETSAEPATD
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Subgroup CAR This EFD conserves 9/9 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
202 Arg (R) side chain Interacts with substrate substrate binding -- binding ICS PubMed:10673434
248 His (H) side chain Interacts with diphosphate moiety of isoprenoid substrate binding -- binding ICS PubMed:10673434
291 Arg (R) side chain Interacts with diphosphate moiety of isoprenoid substrate binding -- binding ICS PubMed:10673434
294 Lys (K) side chain Interacts with diphosphate moiety of isoprenoid substrate binding -- binding ICS PubMed:10673434
297 Asp (D) side chain Zn ligand metal ligand -- binding ICS PubMed:10673434
299 Cys (C) side chain Zn ligand metal ligand -- binding ICS PubMed:10673434
300 Tyr (Y) side chain Interacts with diphosphate moiety of isoprenoid substrate binding -- binding ICS PubMed:10673434
359 Asp (D) side chain Stabilizes Zn binding His electrostatic stabiliser -- spectator ICS PubMed:10673434
362 His (H) side chain Zn ligand metal ligand -- binding ICS PubMed:10673434

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
1TN6 Protein Farnesyltransferase Complexed With A Rap2A Peptide Substrate And A Fpp Analog At 1.8A Resolution Protein Farnesyltransferase Alpha Subunit
(2 more ⇓) 		95 1.8 Yes Sucrose
(3 more ⇓) 		CSA • PDB • PDBSum
2IEJ Human Protein Farnesyltransferase Complexed With Inhibitor Compound Stn-48 And Fpp Analog At 1.8A Resolution Proteinfarnesyltransferase/Geranylgeranyltransferase Type I Alphasubunit • Protein Farnesyltransferase Subunit Beta 95 1.8 Sucrose
(4 more ⇓) 		CSA • PDB • PDBSum
2H6F Protein Farnesyltransferase Complexed With A Farnesylated Ddptasacvls Peptide Product At 1.5A Resolution Proteinfarnesyltransferase/Geranylgeranyltransferase Type I Alphasubunit
(2 more ⇓) 		95 1.5 Yes Sucrose
(3 more ⇓) 		CSA • PDB • PDBSum
1MZC Co-Crystal Structure Of Human Farnesyltransferase With Farnesyldiphosphate And Inhibitor Compound 33A Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 95 2.0 Sucrose
(3 more ⇓) 		CSA • PDB • PDBSum
3E37 Protein Farnesyltransferase Complexed With Bisubstrate Ethylenediamine Scaffold Inhibitor 5 Proteinfarnesyltransferase/Geranylgeranyltransferase Type-1Subunit Alpha • Protein Farnesyltransferase Subunit Beta 95 1.8 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1JCQ Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate And The Peptidomimetic Inhibitor L-739,750 Protein Farnesyltransferase, Alpha Subunit • Protein Farnesyltransferase, Beta Subunit 95 2.3 Yes Sucrose
(4 more ⇓) 		CSA • PDB • PDBSum
1SA4 Human Protein Farnesyltransferase Complexed With Fpp And R115777 Proteinfarnesyltransferase/Geranylgeranyltransferase Type I Alphasubunit • Protein Farnesyltransferase Beta Subunit 95 2.1 Sucrose
(3 more ⇓) 		CSA • PDB • PDBSum
1S63 Human Protein Farnesyltransferase Complexed With L-778,123 And Fpp Proteinfarnesyltransferase/Geranylgeranyltransferase Type I Alphasubunit • Protein Farnesyltransferase Beta Subunit 95 1.9 Sucrose
(3 more ⇓) 		CSA • PDB • PDBSum
1LD8 Co-Crystal Structure Of Human Farnesyltransferase With Farnesyldiphosphate And Inhibitor Compound 49 Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 95 1.8 Sucrose
(4 more ⇓) 		CSA • PDB • PDBSum
1LD7 Co-Crystal Structure Of Human Farnesyltransferase With Farnesyldiphosphate And Inhibitor Compound 66 Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 95 2.0 Sucrose
(3 more ⇓) 		CSA • PDB • PDBSum
2F0Y Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate And Hydantoin Derivative Proteinfarnesyltransferase/Geranylgeranyltransferase Type I Alphasubunit • Protein Farnesyltransferase Beta Subunit 95 2.7 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
2H6H Y365F Protein Farnesyltransferase Mutant Complexed With A Farnesylated Ddptasacvls Peptide Product At 1.8A Protein Farnesyltransferase/Geranylgeranyltransferase Typei Alpha Subunit
(2 more ⇓) 		95 1.8 Yes Sucrose
(3 more ⇓) 		CSA • PDB • PDBSum
2H6G W102T Protein Farnesyltransferase Mutant Complexed With A Geranylgeranylated Ddptasacvls Peptide Product At 1.85A Resolution Protein Farnesyltransferase/Geranylgeranyltransferase Typei Alpha Subunit
(2 more ⇓) 		95 1.85 Yes Sucrose
(2 more ⇓) 		CSA • PDB • PDBSum
2H6I W102T/Y365F Protein Farnesyltransferase Double Mutant Complexed With A Geranylgeranylated Ddptasacvls Peptide Product At 3.0A Protein Farnesyltransferase/Geranylgeranyltransferase Typei Alpha Subunit
(2 more ⇓) 		92 3.0 Yes Sucrose
(2 more ⇓) 		CSA • PDB • PDBSum
1TN8 Protein Farnesyltransferase Complexed With A H-Ras Peptide Substrate And A Fpp Analog At 2.25A Resolution Proteinfarnesyltransferase/Geranylgeranyltransferase Type I Alphasubunit
(2 more ⇓) 		93 2.25 Yes Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1KZP Protein Farnesyltransferase Complexed With A Farnesylated K-Ras4B Peptide Product Protein Farnesyltransferase Alpha Subunit
(2 more ⇓) 		93 2.1 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
3E32 Protein Farnesyltransferase Complexed With Fpp And Ethylenediamine Scaffold Inhibitor 2 Proteinfarnesyltransferase/Geranylgeranyltransferase Type-1Subunit Alpha • Protein Farnesyltransferase Subunit Beta 93 2.45 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1QBQ Structure Of Rat Farnesyl Protein Transferase Complexed With A Cvim Peptide And Alpha-Hydroxyfarnesylphosphonic Acid. Fpt Alpha-Subunit
(2 more ⇓) 		93 2.4 Acetyl Group
(4 more ⇓) 		CSA • PDB • PDBSum
3E33 Protein Farnesyltransferase Complexed With Fpp And Ethylenediamine Scaffold Inhibitor 7 Proteinfarnesyltransferase/Geranylgeranyltransferase Type-1Subunit Alpha • Protein Farnesyltransferase Subunit Beta 93 1.9 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
3E30 Protein Farnesyltransferase Complexed With Fpp And Ethylene Diamine Inhibitor 4 Proteinfarnesyltransferase/Geranylgeranyltransferase Type-1Subunit Alpha • Protein Farnesyltransferase Subunit Beta 93 2.45 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
3DPY Protein Farnesyltransferase Complexed With Fpp And Caged Tkcvim Substrate Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit Alpha
(2 more ⇓) 		93 2.7 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1O5M Structure Of Fpt Bound To The Inhibitor Sch66336 Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 93 2.3 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
3KSL Structure Of Fpt Bound To Datfp-Dh-Gpp Farnesyltransferase, Caax Box, Alpha • Protein Farnesyltransferase Subunit Beta 93 2.05 Magnesium Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1TN7 Protein Farnesyltransferase Complexed With A Tc21 Peptide Substrate And A Fpp Analog At 2.3A Resolution Protein Farnesyltransferase Alpha Subunit
(2 more ⇓) 		93 2.3 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1JCR Crystal Structure Of Rat Protein Farnesyltransferase Complexed With The Non-Substrate Tetrapeptide Inhibitor Cvfm And Farnesyl Diphosphate Substrate Protein Farnesyltransferase, Alpha Subunit
(2 more ⇓) 		93 2.0 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1JCS Crystal Structure Of Rat Protein Farnesyltransferase Complexed With The Peptide Substrate Tkcvfm And An Analog Of Farnesyl Diphosphate Protein Farnesyltransferase, Alpha Subunit
(2 more ⇓) 		93 2.2 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1SA5 Rat Protein Farnesyltransferase Complexed With Fpp And Bms-214662 Proteinfarnesyltransferase/Geranylgeranyltransferase Type I Alphasubunit • Protein Farnesyltransferase Beta Subunit 93 2.6 Zinc Ion
(3 more ⇓) 		CSA • PDB • PDBSum
1FT1 Crystal Structure Of Protein Farnesyltransferase At 2.25 Angstroms Resolution Protein Farnesyltransferase • Protein Farnesyltransferase 93 2.25 Zinc Ion CSA • PDB • PDBSum
1D8E Zinc-Depleted Ftase Complexed With K-Ras4B Peptide Substrate And Fpp Analog. Farnesyltranserase (Alpha Subunit)
(2 more ⇓) 		93 3.0 Acetate Ion • [(3,7,11-Trimethyl-Dodeca-2,6,10-Trienyloxycarbamoyl)-Methyl]-Phosphonic Acid CSA • PDB • PDBSum
1D8D Co-Crystal Structure Of Rat Protein Farnesyltransferase Complexed With A K-Ras4B Peptide Substrate And Fpp Analog At 2.0A Resolution Farnesyltransferase (Alpha Subunit)
(2 more ⇓) 		93 2.0 Acetate Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1FPP Protein Farnesyltransferase Complex With Farnesyl Diphosphate Protein Farnesyltransferase • Protein Farnesyltransferase 93 2.75 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
3KSQ Discovery Of C-Imidazole Azaheptapyridine Fpt Inhibitors Farnesyltransferase, Caax Box, Alpha • Protein Farnesyltransferase Subunit Beta 93 2.1 Magnesium Ion
(3 more ⇓) 		CSA • PDB • PDBSum
1KZO Protein Farnesyltransferase Complexed With Farnesylated K-Ras4B Peptide Product And Farnesyl Diphosphate Substrate Bound Simultaneously Protein Farnesyltransferase Alpha Subunit
(2 more ⇓) 		93 2.2 Zinc Ion
(3 more ⇓) 		CSA • PDB • PDBSum
3E34 Protein Farnesyltransferase Complexed With Fpp And Ethylenediamine-Scaffold Inhibitor 10 Proteinfarnesyltransferase/Geranylgeranyltransferase Type-1Subunit Alpha • Protein Farnesyltransferase Subunit Beta 93 2.05 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
2ZIS Crystal Structure Of Rat Protein Farnesyltransferase Complexed With A Bezoruran Inhibitor And Fpp Protein Farnesyltransferase Subunit Alpha • Protein Farnesyltransferase Subunit Beta 93 2.6 Yes Zinc Ion
(4 more ⇓) 		CSA • PDB • PDBSum
2ZIR Crystal Structure Of Rat Protein Farnesyltransferase Complexed With A Benzofuran Inhibitor And Fpp Protein Farnesyltransferase Subunit Alpha • Protein Farnesyltransferase Subunit Beta 93 2.4 Yes Zinc Ion
(3 more ⇓) 		CSA • PDB • PDBSum
1N94 Aryl Tetrahydropyridine Inhbitors Of Farnesyltransferase: Glycine, Phenylalanine And Histidine Derivates Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 95 3.5 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1X81 Farnesyl Transferase Structure Of Jansen Compound Proteinfarnesyltransferase/Geranylgeranyltransferase Type I Alphasubunit • Protein Farnesyltransferase Beta Subunit 95 3.5 Zinc Ion • 6-[(S)-Amino(4-Chlorophenyl)(1-Methyl-1H-Imidazol-5-Yl)Methyl]-4-(3-Chlorophenyl)-1-Methylquinolin-2(1H)-One CSA • PDB • PDBSum
3PZ4 Crystal Structure Of Ftase(Alpha-Subunit; Beta-Subunit Delta C10) In Complex With Bms3 And Lipid Substrate Fpp Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit Alpha • Protein Farnesyltransferase Subunit Beta 95 2.1 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1NL4 Crystal Structure Of Rat Farnesyl Transferase In Complex With A Potent Biphenyl Inhibitor Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 96 2.7 Yes Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
2R2L Structure Of Farnesyl Protein Transferase Bound To Pb-93 Farnesyltransferase Subunit Alpha • Farnesyltransferase Subunit Beta 96 2.23 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
2BED Structure Of Fpt Bound To Inhibitor Sch207736 Proteinfarnesyltransferase/Geranylgeranyltransferase Type I Alphasubunit • Protein Farnesyltransferase Beta Subunit 96 2.7 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1FT2 Co-Crystal Structure Of Protein Farnesyltransferase Complexed With A Farnesyl Diphosphate Substrate Protein Farnesyltransferase • Protein Farnesyltransferase 96 3.4 Zinc Ion • Farnesyl Diphosphate CSA • PDB • PDBSum
1O1S Structure Of Fpt Bound To Isoprenoid Analog 3B Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 95 2.3 Zinc Ion • (2E,6E)-8-[(3-Benzoylbenzyl)Oxy]-3,7-Dimethylocta-2,6-Dienyl Trihydrogen Diphosphate CSA • PDB • PDBSum
1O1R Structure Of Fpt Bound To Ggpp Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 95 2.3 Zinc Ion • Geranylgeranyl Diphosphate CSA • PDB • PDBSum
3EU5 Crystal Structure Of Ftase(Alpha-Subunit; Beta-Subunit Delta C10) In Complex With Biotingpp Proteinfarnesyltransferase/Geranylgeranyltransferase Type-1Subunit Alpha • Protein Farnesyltransferase Subunit Beta 95 2.8 Zinc Ion • (2E,6E)-3,7-Dimethyl-8-({5-[(3As,4S,6Ar)-2-Oxohexahydro-1H-Thieno[3,4-D]Imidazol-4-Yl]Pentanoyl}Amino)Octa-2,6-Dien-1-Yl Trihydrogen Diphosphate CSA • PDB • PDBSum
1O1T Structure Of Fpt Bound To The Cvim-Fpp Product Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 95 2.1 Magnesium Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1NI1 Imidazole And Cyanophenyl Farnesyl Transferase Inhibitors Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 96 2.3 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1N95 Aryl Tetrahydrophyridine Inhbitors Of Farnesyltranferase: Glycine, Phenylalanine And Histidine Derivatives Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 96 2.3 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
1N9A Farnesyltransferase Complex With Tetrahydropyridine Inhibitors Protein Farnesyltransferase Alpha Subunit • Protein Farnesyltransferase Beta Subunit 96 3.2 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
4GTO Ftase In Complex With Bms Analogue 14 Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit Alpha • Protein Farnesyltransferase Subunit Beta 95 2.15 Zinc Ion
(3 more ⇓) 		CSA • PDB • PDBSum
4GTM Ftase In Complex With Bms Analogue 11 Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit Alpha • Protein Farnesyltransferase Subunit Beta 95 2.2 Zinc Ion
(3 more ⇓) 		CSA • PDB • PDBSum
4GTR Ftase In Complex With Bms Analogue 13 Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit Alpha • Protein Farnesyltransferase Subunit Beta 95 2.2 Dimethyl Sulfoxide
(3 more ⇓) 		CSA • PDB • PDBSum
4GTQ Ftase In Complex With Bms Analogue 12 Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit Alpha • Protein Farnesyltransferase Subunit Beta 95 2.6 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
4GTP Ftase In Complex With Bms Analogue 16 Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit Alpha • Protein Farnesyltransferase Subunit Beta 95 2.75 Dimethyl Sulfoxide
(3 more ⇓) 		CSA • PDB • PDBSum
3EUV Crystal Structure Of Ftase(Alpha-Subunit; Beta-Subunit Delta C10, W102T, Y154T) In Complex With Biotingpp Proteinfarnesyltransferase/Geranylgeranyltransferase Type-1Subunit Alpha • Protein Farnesyltransferase Subunit Beta 88 2.75 Yes Zinc Ion • (2E,6E)-3,7-Dimethyl-8-({5-[(3As,4S,6Ar)-2-Oxohexahydro-1H-Thieno[3,4-D]Imidazol-4-Yl]Pentanoyl}Amino)Octa-2,6-Dien-1-Yl Trihydrogen Diphosphate CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 3, 2014, 4:10 a.m. update curation agent sbrown setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.