Top Level Name

  ⌊ Superfamily (core) Isoprenoid Synthase Type II

    ⌊ Subgroup Complement C3/C4 Like

  ⌊ FunctionalDomain uncharacterized Complement C3/C4 Like subgroup sequence, Isoprenoid Synthase Type II superfamily (ID 1448802)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onFeb. 8, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Homo sapiens Taxon ID: 9606 40737474 AAR89155.1 (Genbank) PRP URP
Homo sapiens Taxon ID: 9606 40737476 AAR89156.1 (Genbank) PRP URP

Uniprot

Protein NameAccessionEC Number Identifier
Complement C4-A P0C0L4 CO4A_HUMAN (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 534 | Length of Functional Domain: 242

1       10        20        30        40        50        60

GQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQ
AGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGL
SLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSP
VEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVL
QIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGS
EGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQK
GYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQ
QADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEAS
ISKASSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4FXG Complement C4 In Complex With Masp-2 Complement C4 Beta Chain
(4 more ⇓) 		28 3.75 O-Sulfo-L-Tyrosine
(2 more ⇓) 		CSA • PDB • PDBSum
4FXK Human Complement C4 Complement C4 Beta Chain
(2 more ⇓) 		28 3.6 N-Acetyl-D-Glucosamine • Beta-D-Mannose CSA • PDB • PDBSum
4XAM Complement Component C4B Complement C4-B
(2 more ⇓) 		28 4.2 CSA • PDB • PDBSum
5JPM Structure Of The Complex Of Human Complement C4 With Masp-2 Rebuilt Using Imdff Complement C4-A
(4 more ⇓) 		28 3.75 Yes O-Sulfo-L-Tyrosine
(2 more ⇓) 		CSA • PDB • PDBSum
5JPN Structure Of Human Complement C4 Rebuilt Using Imdff Complement C4-A
(2 more ⇓) 		28 3.6 N-Acetyl-D-Glucosamine
(4 more ⇓) 		CSA • PDB • PDBSum
5JTW Crystal Structure Of Complement C4B Re-Refined Using Imdff Complement C4-A
(2 more ⇓) 		28 3.5 N-Acetyl-D-Glucosamine CSA • PDB • PDBSum
1HZF C4Adg Fragment Of Human Complement Factor C4A Complement Factor C4A 16 2.3 Selenomethionine CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 2, 2014, 3:04 a.m. update curation agent sbrown setDomainBoundaries.py
update domain end position 499 534
update domain start position 324 293
EC number assigned by UniProtKB accession ID.