Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup mandelate racemase

     ⌊ Family L-lyxonate dehydratase

  ⌊ FunctionalDomain L-lyxonate dehydratase (ID 14261)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code IES PubMed:24947666
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Verminephrobacter eiseniae Taxon ID: 364317 500134444 WP_011810449.1 (RefSeq)
Verminephrobacter eiseniae EF01-2 Taxon ID: 391735 121554302 ABM58451.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a A1WLE4 A1WLE4_VEREI (TrEMBL)

Sequence

Length of Enzyme (full-length): 398 | Length of Functional Domain: 398

1       10        20        30        40        50        60

MKIKSVRARIHEWKGKTVPPQGNFCSNAMDMIFDNKASPHAAGADTMNTFRFHCWTVVEV
ETDDGIVGLGNVALAPRIAKAIIDEYLTPLILGQDPWDYEYLNQRMYRATQAWGRKGVGM
AAISAIDIAIWDILGKSVNKPVFKLLGGRTKEKIPCYYSKLYHTDLKEMQAEAQKFKDQG
FKAFKMRFGYGPAHGQRGVVENLKSVEAVREVIGYDNDLMLECYMGWNVEYAKRILPKLE
KYQPRWLEEPVLADDIDGYAELNQLTSIPISGGEHEFSLYGFKQLLDRKAVSVVQYDTNR
VGGITMAHKINALCEAYSVPVIPHAGQMHNYHLTMSSLNCPISEYFPIFDVEIGNELFYY
IFDGDPAAENGFLQLDDNKPGLGLTLKTEYLEHFTITE
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
222 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
248 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
274 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 5/5 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
222 Glu (E) side chain metal binding ligand metal ligand -- binding ICS
248 Glu (E) side chain metal binding ligand metal ligand -- binding ICS
274 Glu (E) side chain metal binding ligand metal ligand -- binding ICS
297 Asp (D) side chain controls pKa of catalytic His perturbates pKa -- spectator IDA
324 His (H) side chain proton abstraction (general base) proton relay -- reactant IDA
Family CAR This EFD conserves 7/7 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
185 Lys (K) side chain Electrophile electrophile -- reactant ISS PubMed:24831290
187 Arg (R) side chain None -- IME PubMed:24831290
222 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:24831290
248 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:24831290
274 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:24831290
297 Asp (D) side chain General base proton relay -- reactant ISS PubMed:24831290
324 His (H) side chain Forms hydrogen bond dyad with Asp general base activation -- spectator IME PubMed:24831290

Catalyzed Reaction

L-lyxonate dehydratase

+
L-Lyxonate
6268		 2-dehydro-3-deoxy-L-arabinonic acid
17647		 water
15377

EC: 4.2.1.- | IntEnz: 4.2.1.- | Kegg: 4.2.1.- | BioCyc: 4.2.1.- | BRENDA: 4.2.1.- |

Curation History
Time Change Annotation Old Value New Value
Nov. 3, 2014, 2:36 a.m. update curation agent updateSFLD2.py setDomainBoundaries.py
July 9, 2015, 3:10 a.m. update curation agent setDomainBoundaries.py sbrown
update curation agent sbrown setDomainBoundaries.py
update family assignment evidence code IEA IES
update name uncharacterized mandelate racemase subgroup sequence, enolase superfamily L-lyxonate dehydratase
update superfamily assignment evidence code IEA ISS
EC number assigned by UniProtKB accession ID.