Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup mandelate racemase

     ⌊ Family L-galactonate dehydratase

  ⌊ FunctionalDomain L-galactonate dehydratase (ID 13875)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code IES PubMed:16879654
This entry was last updated onNov. 21, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Trichoderma reesei QM6a Taxon ID: 431241 589101557 XP_006962801.1 (RefSeq) URP
Trichoderma reesei RUT C-30 Taxon ID: 1344414 572281284 ETS04308.1 (Genbank) URP
Trichoderma reesei QM6a Taxon ID: 431241 340521049 EGR51284.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
L-galactonate dehydratase Q0QWS4 4.2.1.146 LGD1_HYPJE (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 450 | Length of Functional Domain: 450

1       10        20        30        40        50        60

MSEVTITGFRSRDVRFPTSLDKTGSDAMNAAGDYSAAYCILETDSAHSGHGMTFTIGRGN
DIVCAAINHVADRLKGKKLSSLVADWGKTWRYLVNDSQLRWIGPEKGVIHLALGAVVNAV
WDLWAKTLNKPVWRIVADMTPEEYVRCIDFRYITDAITPEEAVAMLREQEAGKAKRIEEA
LQNRAVPAYTTSAGWLGYGEDKMKQLLRETLAAGYRHFKVKVGGSVEEDRRRLGIAREIL
GFDKGNVLMVDANQVWSVPEAIDYMKQLSEYKPWFIEEPTSPDDIMGHKAIRDALKPYGI
GVATGEMCQNRVMFKQLIMTGAIDICQIDACRLGGVNEVLAVLLMAKKYGVPIVPHSGGV
GLPEYTQHLSTIDYVVVSGKLSVLEFVDHLHEHFLHPSVIKDGYYQTPTEAGYSVEMKPE
SMDKYEYPGKKGVSWWTTDEALPILNGEKI
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
251 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
277 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
306 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 5/5 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
251 Asp (D) side chain metal binding ligand metal ligand -- binding ICS
277 Glu (E) side chain metal binding ligand metal ligand -- binding ICS
306 Glu (E) side chain metal binding ligand metal ligand -- binding ICS
329 Asp (D) side chain controls pKa of catalytic His perturbates pKa -- spectator IDA
356 His (H) side chain proton abstraction (general base) proton relay -- reactant IDA
Family CAR This EFD conserves 6/6 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
221 Lys (K) side chain abstracts alpha proton (base); donates proton to enediolate intermediate proton relay -- reactant ISS
251 Asp (D) side chain metal binding ligand metal ligand -- binding ISS
277 Glu (E) side chain metal binding ligand metal ligand -- binding ISS
306 Glu (E) side chain metal binding ligand metal ligand -- binding ISS
329 Asp (D) side chain Controls pKa of catalytic Histidine perturbates pKa -- spectator ISS
356 His (H) side chain acid catalyst for beta elimination reaction proton relay -- reactant ISS

Catalyzed Reaction

L-galactonate dehydratase

+
L-galactonate
53071		 2-keto-3-deoxy-L-galactonate
75545		 water
15377

EC: 4.2.1.146 | IntEnz: 4.2.1.146 | Kegg: 4.2.1.146 | BioCyc: 4.2.1.146 | BRENDA: 4.2.1.146

Curation History
Time Change Annotation Old Value New Value
April 30, 2014, 2:28 a.m. update curation agent sbrown setDomainBoundaries.py
update domain end position 437 450
update domain start position 5 1
Nov. 21, 2017, 3:56 a.m. update family assignment evidence code ISS IES
EC number assigned by UniProtKB accession ID.