Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup mandelate racemase
⌊ Family rhamnonate dehydratase
⌊ FunctionalDomain rhamnonate dehydratase (ID 1284738)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 21, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica subsp. enterica serovar Cubana str. 76814 Taxon ID: 1192560 | 564141044 | ETA86474.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cubana str. CVM42234 Taxon ID: 1314885 | 560206152 | ESV52437.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky str. 5349 Taxon ID: 1029980 | 554242425 | ESG79321.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky str. 20793 Taxon ID: 1124954 | 549579636 | ERN84381.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky str. N312 Taxon ID: 1124953 | 549572315 | ERN77220.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky str. 13562 Taxon ID: 1124950 | 549565217 | ERN70461.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky str. 29166 Taxon ID: 1124951 | 549564445 | ERN69698.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Kentucky str. 22694 Taxon ID: 1124952 | 549563987 | ERN69247.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050 Taxon ID: 1271863 | 523818535 | AGQ73816.1 (Genbank) | URP |
| obsolete GIs = 527084738, 525858294, 446349968 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | V7IMD3 | V7IMD3_SALET (TrEMBL) | |
| n/a | S5HN02 | S5HN02_SALET (TrEMBL) |
Length of Enzyme (full-length): 405 | Length of Functional Domain: 405
MENIMTLPKIKHVRAWFIGGATAEKGAGGGDYHDQGGNHWIDDHIATPMSKYRDYEQSRQ
SFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVEKHLNRFIEGKCVSDIKLIHDQML
GATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDLA
KEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGPDFWLMLDCWMSQDVNYATKLA
HACAPFNLKWIEECLPPQQYEGYRELKRNAPAGMMVTSGEHHGTLQSFRTLAETGIDIMQ
PDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLMTSPDCSTL
RPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNRDCRLKRPYSH
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



