Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like
⌊ FunctionalDomain C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like (ID 116576)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 445952180 | WP_000030035.1 (RefSeq) | URP |
| Escherichia coli 5905 Taxon ID: 1005558 | 408162217 | EKH90132.1 (Genbank) | URP |
| Escherichia coli O55:H7 str. USDA 5905 Taxon ID: 926030 | 320661947 | EFX29355.1 (Genbank) | URP |
| obsolete GIs = 425251051, 416822140 | |||
Length of Enzyme (full-length): 188 | Length of Functional Domain: 163
MSKAGASLVTCYGPVSADVIAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGY
GIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSDLLEKLAIAPENV
AYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGKL
DEAKGQSI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



