Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Prostaglandin E synthase like

  ⌊ Prostaglandin E synthase like.1

  ⌊ FunctionalDomain cytGST-like protein (ID 58809)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Pan troglodytes Taxon ID: 9598 350537055 NP_001233456.1 (RefSeq) PRP URP
Homo sapiens Taxon ID: 9606 13376617 NP_079348.1 (RefSeq) PRP URP
synthetic construct Taxon ID: 32630 649151918 AIC62817.1 (Genbank)
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Prostaglandin E synthase 2 Q9H7Z7 PGES2_HUMAN (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 377 | Length of Functional Domain: 356

1       10        20        30        40        50        60

MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLG
AAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFL
DFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQ
PLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADD
WLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQ
PWYLRVERAITEASPAH
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Subgroup CAR This EFD conserves 1/1 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
110 Cys (C) side chain None -- IME PubMed:12804604

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
1Z9H Microsomal Prostaglandin E Synthase Type-2 Membrane-Associated Prostaglandin E Synthase-2 76 2.6 Chloride Ion
(2 more ⇓) 		CSA • PDB • PDBSum
2PBJ Gsh-Heme Bound Microsomal Prostaglandin E Synthase Prostaglandin E Synthase 2 76 2.8 Chloride Ion
(2 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 3, 2014, 6:38 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 377 369
update domain start position 1 102
Aug. 16, 2016, 8:32 a.m. update domain end position 369 377
update domain start position 102 22
EC number assigned by UniProtKB accession ID.