Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup anaerobic coproporphyrinogen-III oxidase like
⌊ FunctionalDomain uncharacterized Anaerobic Coproporphyrinogen-III Oxidase subgroup sequence (ID 439250)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica subsp. enterica serovar Alachua str. R6-377 Taxon ID: 913241 | 353563667 | EHC29950.1 (Genbank) | URP |
| obsolete GIs = 417337733, 486362636 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | G5LW81 | G5LW81_SALET (TrEMBL) |
Length of Enzyme (full-length): 179 | Length of Functional Domain: 179
MARYPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIRHRAPLFADRH
VSQLHWGGGTPTYLNKAQISRLMTLLRENFHFNTDAEISIEVDPREIELDVLDHLRAEGF
NRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHARDIGFTSTNIDLIYGLPKQTPESFA
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



