Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup anaerobic coproporphyrinogen-III oxidase like
⌊ FunctionalDomain uncharacterized anaerobic coproporphyrinogen-III oxidase-like sequence (ID 431287)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica subsp. enterica serovar Johannesburg str. S5-703 Taxon ID: 913077 | 353601500 | EHC57120.1 (Genbank) | URP |
| obsolete GIs = 417387068, 487183569 | |||
Length of Enzyme (full-length): 223 | Length of Functional Domain: 222
MSEQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFEDAAFLQAVARYPERPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIRHRAPLFANRHVSQLHWGGGTPTYLNK
AQISRLMTLLRENFHFNTDAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQR
LVNREQDEEFIFALLNHARDIGFTSTNIDLIYGLPKQTPESFA
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



