Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup spectinomycin biosynthesis (SpcY-like)

     ⌊ Family spectinomycin biosynthesis (SpcY-like)

  ⌊ FunctionalDomain SpcY (ID 419742)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:19058170
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces netropsis Taxon ID: 55404 5579429 AAD45550.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q9S1L5 Q9S1L5_STRNE (TrEMBL)

Sequence

Length of Enzyme (full-length): 302 | Length of Functional Domain: 302

1       10        20        30        40        50        60

MSVHVEHGKVINPEGVEINASLQCNMRCKSCAHLSPLFRKENADPAETHDILTLLARNYH
ASYAKIMGGEPLLHPDIVGLIEAVRTSRVADTVLVATNGTLLDRASEEFWRAVDSLEISV
YPSRPLTSEQIDRYHGMAREYDVSLLINHYGHFREIYSETGADSPELVQDVYDTCKLAHY
WRSHTVYDGWLYRCPQSLFVPQQLENGGWDPREDGIEIADDPGFLERLHRFLTRTTPLRA
CGNCLGSVGRLHQHTELARKEWRPKEKLEELIDYEFLELCKSDITTDDGCVDSSSSVSRE
AG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
24 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
28 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
31 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
24 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
28 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
31 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
24 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
28 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
31 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reaction

TDP-rhammose dehydrogenase

+ + + +
S-adenosyl-L-methionine zwitterion
59789		 TDP-beta-L-rhamnose(2-)
86407		 water
15377		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319		 TDP-actinospectose(2-)
86408

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:08 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 139 302
update domain start position 18 1
Aug. 15, 2014, 5:23 a.m. update curation agent setDomainBoundaries.py holliday
update superfamily assignment evidence code IEA ISS
Oct. 16, 2014, 6:47 a.m. update curation agent holliday setDomainBoundaries.py
Dec. 17, 2015, 5:53 a.m. update curation agent setDomainBoundaries.py holliday
remove family assignment evidence code CFM,ISS -
remove family spectinomycin biosynthesis (SpcY-like) -
update name SpcY uncharacterized Radical SAM superfamily sequence
remove subgroup spectinomycin biosynthesis (SpcY-like) -
update superfamily assignment evidence code ISS IEA
Oct. 15, 2016, 6:31 a.m. update curation agent holliday setDomainBoundaries.py
create family assignment evidence code - CFM
create family - spectinomycin biosynthesis (SpcY-like)
update name uncharacterized Radical SAM superfamily sequence SpcY
create subgroup - spectinomycin biosynthesis (SpcY-like)
update superfamily assignment evidence code IEA ISS
EC number assigned by UniProtKB accession ID.