Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup spore photoproduct lyase like

  ⌊ FunctionalDomain uncharacterized Radical SAM superfamily sequence (ID 407198)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Geobacillus sp. G11MC16 Taxon ID: 495036 496155320 WP_008879827.1 (RefSeq) URP
Geobacillus sp. G11MC16 Taxon ID: 495036 196211755 EDY06514.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A0Q0ZPX6 A0A0Q0ZPX6_9BACI (TrEMBL)

Sequence

Length of Enzyme (full-length): 341 | Length of Functional Domain: 341

1       10        20        30        40        50        60

MKPFVPKLVYFEPEALSYPLGKELYEKFTQMGIEIRETTSHNQVRGIPGETELARYRNAK
STLVVGVRRTLKFDSSKPSAEYAIPLATGCMGHCHYCYLQTTLGSKPYIRVYVNLDDIFA
QAQKYINERAPEITRFEAACTSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDH
LLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLVAARKVAGAGYKLGFVVAPIYRHE
GWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKY
KWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
90 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
94 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
97 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 4/4 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
90 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
94 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
97 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
98 Tyr (Y) side chain Hydrogen radical shuttle hydrogen relay -- reactant IEA

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4FHD Spore Photoproduct Lyase Complexed With Dinucleoside Spore Photoproduct Spore Photoproduct Lyase 5 2.0 Iron/Sulfur Cluster
(4 more ⇓) 		CSA • PDB • PDBSum
4FHC Spore Photoproduct Lyase Spore Photoproduct Lyase 5 2.2 Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
4FHF Spore Photoproduct Lyase C140A Mutant With Dinucleoside Spore Photoproduct Spore Photoproduct Lyase 5 2.3 Yes Iron/Sulfur Cluster
(4 more ⇓) 		CSA • PDB • PDBSum
4FHE Spore Photoproduct Lyase C140A Mutant Spore Photoproduct Lyase 5 2.0 Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
4FHG Spore Photoproduct Lyase C140S Mutant Spore Photoproduct Lyase 5 2.0 Yes Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
4K9R Spore Photoproduct Lyase Y98F Mutant Spore Photoproduct Lyase 5 2.3 Yes Iron/Sulfur Cluster
(2 more ⇓) 		CSA • PDB • PDBSum
4RH1 Spore Photoproduct Lyase C140A/S76C Mutant With Bound Adomet And Dinucleoside Spore Photoproduct Spore Photoproduct Lyase 5 2.6 Yes Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
4RH0 Spore Photoproduct Lyase C140A/S76C Mutant With Bound Adomet Spore Photoproduct Lyase 5 2.1 Yes [(3S)-3-Amino-4-Hydroxy-4-Oxo-Butyl]-[[(2S,3S,4R,5R)-5-(6-Aminopurin-9-Yl)-3,4-Dihydroxy-Oxolan-2-Yl]Methyl]-Methyl-Selanium
(3 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 2:53 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 192 341
update domain start position 19 1
July 15, 2014, 5:55 a.m. update classification public staff
update curation agent setDomainBoundaries.py holliday
remove family assignment evidence code IEA -
remove family spore photoproduct lyase 1 -
update superfamily assignment evidence code ISS IEA
Aug. 15, 2014, 5:03 a.m. update classification staff public
Oct. 16, 2014, 6:12 a.m. update curation agent holliday setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.