Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup anaerobic coproporphyrinogen-III oxidase like

  ⌊ methyltransferase (class C)

     ⌊ Family pyrimidine ring methyltransferase (bleomycin-like antibiotic biosynthesis)

  ⌊ FunctionalDomain pyrimidine ring methyltransferase (tallysomycin antibiotic biosynthesis) (Tlm Orf11) (ID 404991)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:17216057
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptoalloteichus hindustanus Taxon ID: 2017 119433794 ABL74954.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
n/a A4KUC6 A4KUC6_STRHI (TrEMBL)

Sequence

Length of Enzyme (full-length): 424 | Length of Functional Domain: 424

1       10        20        30        40        50        60

MNHPISPQQLLTAISEVVRNHPNKKLAVYVHIPFCSSKCHFCDWVTDIPVRRLRSGPEGR
ASYVDALCDQIRFYGPQLTRFGYRPKVMYWGGGTPTRLAPEEMRAIRAALDDSFDFSDLV
QWTVETTPNDLDAEKLAAMREIGVDRVSVGVQSLNPYQLRKAGRAHSREQALAAFPLLRQ
AGITNFNVDLISSFPGEDQESFRRTVEDILALDPPHVSVYPYRATPKTVMAMQLDREFLE
AHQQHDMVATYEMAMEMLGQAGYHEYCHGYWVRDAAHEDHDGNFKYDLEGDKIGFGSGAE
SIIGHHLLWSENTKYEEYLDDPRTFSMAHRFTLDDPERLTAPVGGALMTREGVDFARFHR
LTGVSFADLRATPYFTRWFQVLEECGARFLESDTNFRMDPTVIHKAYITHLAHSTANGLA
PQRA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
35 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
39 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
35 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
39 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
35 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
39 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS

Catalyzed Reaction

Methylation of tallysomycin

+ 2 + + +
TLM intermediate
132417		 S-adenosyl-L-methionine zwitterion
59789		 methylated TLM intermediate
132418		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844		 S-adenosyl-L-homocysteine zwitterion
57856

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 2:51 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 424 423
update domain start position 6 1
Oct. 15, 2016, 5:52 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain end position 423 424
update family - pyrimidine ring methyltransferase (bleomycin-like antibiotic biosynthesis)
update name Tlm Orf11 pyrimidine ring methyltransferase (tallysomycin antibiotic biosynthesis) (Tlm Orf11)
EC number assigned by UniProtKB accession ID.