Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup methylthiotransferase
⌊ FunctionalDomain uncharacterized Radical SAM superfamily sequence (ID 403587)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Thermotoga maritima MSB8 Taxon ID: 243274 | 152149505 | PRP URP | |
| Thermotoga maritima MSB8 Taxon ID: 243274 | 152149504 | PRP URP | |
| Thermotoga maritima MSB8 Taxon ID: 243274 | 152149503 | PRP URP | |
| Thermotoga maritima MSB8 Taxon ID: 243274 | 152149502 | PRP URP | |
| Thermotoga maritima MSB8 Taxon ID: 243274 | 152149501 | PRP URP | |
| Thermotoga maritima MSB8 Taxon ID: 243274 | 152149500 | PRP URP | |
| Thermotoga maritima MSB8 Taxon ID: 243274 | 152149499 | PRP URP | |
| Thermotoga maritima MSB8 Taxon ID: 243274 | 152149498 | PRP URP | |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Ribosomal protein S12 methylthiotransferase RimO {ECO:0000255|HAMAP-Rule:MF_01865} | Q9X2H6 | RIMO_THEMA (Swiss-Prot) |
Length of Enzyme (full-length): 304 | Length of Functional Domain: 299
EERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDT
TSYGIDLYRKQALPDLLRRLNSLNGEFWIRVXYLHPDHLTEEIISAXLELDKVVKYFDVP
VQHGSDKILKLXGRTKSSEELKKXLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQFV
EEIQFDKLGAFVYSDEEGTVAFNLKEKVDPEXAKRRQEELLLLQAEISNSRLDRFVGKKL
KFLVEGKEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDXWGSVILEHH
HHHH
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



