Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup anaerobic coproporphyrinogen-III oxidase like
⌊ FunctionalDomain uncharacterized anaerobic coproporphyrinogen-III oxidase-like sequence (ID 397346)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 446038228 | WP_000116083.1 (RefSeq) | URP |
| Escherichia coli EPECa14 Taxon ID: 670893 | 323155162 | EFZ41349.1 (Genbank) | URP |
| obsolete GI = 415786136 | |||
Length of Enzyme (full-length): 200 | Length of Functional Domain: 199
MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAPLFAGRHVSQLHWGGGTPTYLNK
AQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQR
LVNREQDEEFIFALLNHARE
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



