Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup anaerobic coproporphyrinogen-III oxidase like

  ⌊ methyltransferase (class C)

     ⌊ Family pyrimidine ring methyltransferase (bleomycin-like antibiotic biosynthesis)

  ⌊ FunctionalDomain pyrimidine ring methyltransferase (bleomycin antibiotic biosynthesis) (Blm-Orf8) (ID 396940)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:17216057
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
n/a 75922096 ABA32877.1 (Genbank)
Streptomyces verticillus Taxon ID: 29309 9937241 AAG02372.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q9FB10 Q9FB10_9ACTN (TrEMBL)

Sequence

Length of Enzyme (full-length): 424 | Length of Functional Domain: 424

1       10        20        30        40        50        60

MSHAIGPSRLIPAIREALGDEKDPRLALYVHVPFCSSKCHFCDWVTDIPVARLRGDSRER
SPYVTALCDQIRFYGPQLTRLGYRPEVMYWGGGTPTRLTGDEMTAVHQALDDAFDLTGLR
QWSVESTPNDLDPATLDTLRGLGVTRVSVGVQSLNPYQLRKAGRAHSREQALAAVPLLRR
AGIDEFNVDLIAGFPGEAVESFEETLRTVLALDPPHVSVYPYRATPKTVMAMQLDREFVE
ARNRDGMIDAYERAMAALGAAGYHEYCHGYWVRDARHEDQDGNYKYDLAGDKIGFGSGAE
SIIGHHLLWNENSAYARYLLAPREFSAAHRFTTAEPDRLTAPVGGALMTREGVVFARFRR
LTGLDFADVRATPYFRQWFELLERCGGRFVETPYSLRLEPSTIHRAYITHLAYTMAHGLA
PERA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
35 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
39 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
35 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
39 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
35 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
39 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS

Catalyzed Reaction

methylation of bleomycin

+ 2 + + +
BLM intermediate
132419		 S-adenosyl-L-homocysteine zwitterion
57856		 methylated BLM intermediate
132420		 S-adenosyl-L-homocysteine zwitterion
57856		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 2:46 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 372 423
update domain start position 9 1
Oct. 15, 2016, 5:36 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain end position 423 424
update name Aromatic C-H methyltransferase (Blm-Orf8) pyrimidine ring methyltransferase (bleomycin antibiotic biosynthesis) (Blm-Orf8)
EC number assigned by UniProtKB accession ID.