Top Level Name

  ⌊ FunctionalDomain uncharacterized sequence (ID 381264)

This sequence has not been fully curated yet.
This entry was last updated onFeb. 7, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Haemophilus influenzae Rd KW20 Taxon ID: 71421 16272635 NP_438853.1 (RefSeq) PRP URP
Haemophilus influenzae Taxon ID: 727 499171446 WP_010869033.1 (RefSeq) URP
Haemophilus influenzae Rd KW20 Taxon ID: 71421 1573696 AAC22353.1 (Genbank) PRP URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Lipoprotein E P26093 HEL_HAEIN (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 274 | Length of Functional Domain: 274

1       10        20        30        40        50        60

MKTTLKMTALAALSAFVLAGCGSHQMKSEGHANMQLQQQAVLGLNWMQDSGEYKALAYQA
YNAAKVAFDHAKVAKGKKKAVVADLDETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQS
RAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSA
KAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNAN
YGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGK
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
3OCZ Structure Of Recombinant Haemophilus Influenzae E(P4) Acid Phosphatase Complexed With The Inhibitor Adenosine 5-O-Thiomonophosphate Lipoprotein E 23 1.35 Magnesium Ion • Adenosine -5'-Thio-Monophosphate CSA • PDB • PDBSum
3OCY Structure Of Recombinant Haemophilus Influenzae E(P4) Acid Phosphatase Complexed With Inorganic Phosphate Lipoprotein E 23 1.4 Phosphate Ion • Magnesium Ion CSA • PDB • PDBSum
3SF0 Structure Of Recombinant Haemophilus Influenzae E(P4) Acid Phosphatase Mutant D64N Complexed With 5'Amp Lipoprotein E 23 1.35 Yes Magnesium Ion • Adenosine Monophosphate CSA • PDB • PDBSum
3OCW Structure Of Recombinant Haemophilus Influenzae E(P4) Acid Phosphatase Mutant D66N Complexed With 3'-Amp Lipoprotein E 23 1.85 Yes Magnesium Ion • [(2R,3S,4R,5R)-5-(6-Aminopurin-9-Yl)-4-Hydroxy-2-(Hydroxymethyl)Oxolan-3-Yl] Dihydrogen Phosphate CSA • PDB • PDBSum
3OCV Structure Of Recombinant Haemophilus Influenzae E(P4) Acid Phosphatase Mutant D66N Complexed With 5'-Amp Lipoprotein E 23 1.55 Yes Adenosine Monophosphate • Magnesium Ion CSA • PDB • PDBSum
3OCU Structure Of Recombinant Haemophilus Influenzae E(P4) Acid Phosphatase Mutant D66N Complexed With Nmn Lipoprotein E 23 1.35 Yes Magnesium Ion • Beta-Nicotinamide Ribose Monophosphate CSA • PDB • PDBSum
3OCX Structure Of Recombinant Haemophilus Influenzae E(P4) Acid Phosphatase Mutant D66N Complexed With 2'-Amp Lipoprotein E 23 1.9 Yes Adenosine-2'-Monophosphate • Magnesium Ion CSA • PDB • PDBSum
3ET4 Structure Of Recombinant Haemophilus Influenzae E(P4) Acid Phosphatase Outer Membrane Protein P4, Nadp Phosphatase 23 1.7 Magnesium Ion • Tetraethylene Glycol CSA • PDB • PDBSum
3ET5 Structure Of Recombinant Haemophilus Influenzae E(P4) Acid Phosphatase Complexed With Tungstate Outer Membrane Protein P4, Nadp Phosphatase 23 2.0 Magnesium Ion
(2 more ⇓)
CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.
EC number assigned by UniProtKB accession ID.