Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup anaerobic coproporphyrinogen-III oxidase like
⌊ FunctionalDomain uncharacterized anaerobic coproporphyrinogen-III oxidase-like sequence (ID 380963)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Synechocystis sp. PCC 6803 Taxon ID: 1148 | 499175254 | WP_010872841.1 (RefSeq) | URP |
| Synechocystis sp. PCC 6803 Taxon ID: 1148 | 451780937 | AGF51906.1 (Genbank) | URP |
| Bacillus subtilis BEST7613 Taxon ID: 1204343 | 407961832 | URP | |
| Synechocystis sp. PCC 6803 substr. PCC-P Taxon ID: 1080230 | 359278211 | URP | |
| Synechocystis sp. PCC 6803 substr. PCC-N Taxon ID: 1080229 | 359275041 | URP | |
| Synechocystis sp. PCC 6803 substr. GT-I Taxon ID: 1080228 | 359271871 | URP | |
| Synechocystis sp. PCC 6803 Taxon ID: 1148 | 339273904 | URP | |
| Synechocystis sp. PCC 6803 substr. Kazusa Taxon ID: 1111708 | 3122206 | PRP URP | |
| Synechocystis sp. PCC 6803 Taxon ID: 1148 | 1653303 | URP | |
| obsolete GIs = 433623074, 16330810, 451814968, 384436872, 383491605, 383325721, 383322552 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Oxygen-independent coproporphyrinogen III oxidase | P74132 | HEMN_SYNY3 (Swiss-Prot) |
Length of Enzyme (full-length): 466 | Length of Functional Domain: 463
MTTTFPTVEFSAELLNKYNQGIPRYTSYPPATELNKEFDPSDFQTAINLGNYKKTPLSLY
CHIPFCAKACYFCGCNTIITQHKPAVDPYLKAVAKQIALVAPLVDQQRPVQQLHWGGGTP
NYLTLEQAEFLFNTITDAFPLAENAEISIEINPCYVDKDYIFALRQLGFNRISFGIQDFN
SQVQQAVNRIQPEAMLFQVMDWIRQANFDSVNVDLIYGLPHQNLATFRETLRKTAQLNPD
RIAVFNFAYVPWLKPVQKKMPESALPPAEEKLKIMQATIADLTEQGYVFIGMDHFAKPDD
ELAIAQRRGELHRNFQGYTTQPESDLLGFGITSISMLQDVYAQNHKTLKAFYNALDREVM
PIEKGFKLSQDDLIRRTVIKELMCQFKLSAQELESKYNLGFDCDFNDYFAKELSALDVLE
ADGLLRRLGDGLEVTPRGRILIRNIAAVFDTYLQNKSKQQMFSRAI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.










