Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup anaerobic coproporphyrinogen-III oxidase like
⌊ FunctionalDomain uncharacterized anaerobic coproporphyrinogen-III oxidase-like sequence (ID 2118604)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 693040022 | WP_032212450.1 (RefSeq) | URP |
| Escherichia coli O157:H7 str. K6590 Taxon ID: 1446694 | 607628834 | EZD14872.1 (Genbank) | URP |
Length of Enzyme (full-length): 246 | Length of Functional Domain: 245
MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAPLFAGRHVSQLHWGGGTPTYLNK
AQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQR
LVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVF
NYAHLP
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



