Top Level Name
⌊ Superfamily (extended) Radical SAM Phosphomethylpyrimidine Synthase
⌊ FunctionalDomain uncharacterized Radical SAM Phosphomethylpyrimidine Synthase extended sequence (ID 1888565)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | Jan. 18, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Neisseria sicca Taxon ID: 490 | 518100519 | WP_019270727.1 (RefSeq) |
Length of Enzyme (full-length): 143 | Length of Functional Domain: 143
TAMLCYVTPKEHLGLPDRDDVKTGVITYKLAAHAADLAKGHPGAAMWDDAISRARFEFRW
EDQFNLALDPETARKFHDETLPKEAHKTAHFCSMCGPKFCSMKISQEVRDFAAAKAPNEA
ELGMAAMSEKFKEQGSEIYLKAE
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



