Top Level Name

  ⌊ Superfamily (core) Crotonase

    ⌊ Subgroup crotonase like

     ⌊ Family dodecenoyl-CoA delta-isomerase (mitochondrial)

  ⌊ FunctionalDomain dodecenoyl-CoA delta-isomerase (mitochondrial) (ID 6137)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code IES
This entry was last updated onSept. 2, 2014

References to Other Databases

Genbank

SpeciesGIAccessionModel
Homo sapiens 60593481 MB
Homo sapiens 60593480 MB
Homo sapiens 60593479 MB

Uniprot

Protein NameAccessionEC Number IdentifierModel
Enoyl-CoA delta isomerase 1, mitochondrial P42126 5.3.3.8 ECI1_HUMAN (SwissProt) MB

Sequence

Length of Enzyme (full-length): 260 | Length of Functional Domain: 260

1       10        20        30        40        50        60

GSQRVLVEPDAGAGVAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPG
VFSAGLDLTEMCGRSPAHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCD
YRILADNPRYCIGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGI
VDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFIS
KDSIQKSLQMYLERLKEEKG

FASTA | BLAST | HMM

This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. In many cases the functional domain is the full-length sequence. Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Catalyzed Reaction(s)

isomerization of 3-enoyl-CoA to 2-enoyl-CoA

Evidence Code: IDA

EC: 5.3.3.8 | IntEnz: 5.3.3.8 | Kegg: 5.3.3.8 | BioCyc: 5.3.3.8 | BRENDA: 5.3.3.8

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Chimera Session Links
1SG4 Crystal Structure Of Human Mitochondrial Delta3-Delta2-Enoyl-Coa Isomerase 3,2-Trans-Enoyl-Coa Isomerase, Mitochondrial 12 1.3 Octanoyl-Coenzyme A CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via Uniprot.
EC number assigned by UniProtKB accession ID.