Top Level Name

  ⌊ Superfamily (core) Haloacid Dehalogenase

    ⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like

  C1.5.6: HAD, Beta-PGM, Phosphatase Like

     ⌊ Family 2-haloacid dehalogenase

  ⌊ FunctionalDomain 2-haloacid dehalogenase (ID 2239)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code IES
This entry was last updated onJan. 14, 2017

References to Other Databases

Genbank

SpeciesGIAccessionModel
Xanthobacter autotrophicus 6435583 MB
Xanthobacter autotrophicus 6435582 MB

Uniprot

Protein NameAccessionEC Number IdentifierModel
(S)-2-haloacid dehalogenase Q60099 3.8.1.2 HAD_XANAU (Swiss-Prot) MB

Sequence

Length of Enzyme (full-length): 253 | Length of Functional Domain: 247

1       10        20        30        40        50        60

MIKAVVFDAYGTLFDVQSVADATERAYPGRGEYITQVWRQKQLEYSWLRALMGRYADFWS
VTREALAYTLGTLGLEPDESFLADMAQAYNRLTPYPDAAQCLAELAPLKRAILSNGAPDM
LQALVANAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGA
KNFGFSVARVARLSQEALARELVSGTIAPLTMFKALRMREETYAEAPDFVVPALGDLPRL
VRGMAGA
HLAPAV

FASTA | BLAST | HMM

This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

This EFD conserves 6/6 Family-specific CRs and 3/5 Subgroup-specific CRs.
Position Amino Acid Location Family/Subgroup CAR Function Role Evidence Code Reference
8 Asp (D) side chain family nucleophile: attacks C2 of substrate to form covalent intermediate covalent catalysis -- reactant IDA
8 Asp (D) side chain subgroup Mg2+ ligand, nucleophile: attacks phosphate moiety of intermediate to form covalent intermediate covalent catalysis -- reactant,
metal ligand -- binding
ICS
12 Thr (T) side chain family None -- IDA
114 Ser (S) side chain family stabilizes COOH of intermediate electrostatic stabiliser -- spectator ICS
147 Lys (K) side chain family None -- IDA
147 Lys (K) side chain subgroup None -- ICS
153 Tyr (Y) side chain family None -- IDA
171 Ser (S) side chain subgroup MISMATCH: This residue does not match the specified amino acid type of D,E, and thus may not function in the same manner as other sequences in the subgroup
172 Ser (S) side chain subgroup MISMATCH: This residue does not match the specified amino acid type of D,E, and thus may not function in the same manner as other sequences in the subgroup
176 Asp (D) side chain subgroup Mg2+ ligand
Notes: Sequences in this subgroup may have one or more of the final three D/E listed as Mg2+ ligands
metal ligand -- binding ICS
176 Asp (D) side chain family hydrolysis of ester intermediate proton relay -- reactant IDA

Catalyzed Reaction

(S)-2-haloacid dehalogenase (configuration-inverting)

+ +
(S)-2-haloacid
15791
water
15377
(2R)-2-hydroxy monocarboxylic acid
17893
halide anion
16042

EC: 3.8.1.2 | IntEnz: 3.8.1.2 | Kegg: 3.8.1.2 | BioCyc: 3.8.1.2 | BRENDA: 3.8.1.2

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Chimera Session Links
1QQ5 Structure Of L-2-Haloacid Dehalogenase From Xanthobacter Autotrophicus Protein (L-2-Haloacid Dehalogenase) 5 1.52 Formic Acid CSA • PDB • PDBSum
1AQ6 Structure Of L-2-Haloacid Dehalogenase From Xanthobacter Autotrophicus L-2-Haloacid Dehalogenase 5 1.95 Formic Acid CSA • PDB • PDBSum
1QQ7 Structure Of L-2-Haloacid Dehalogenase From Xanthobacter Autotrophicus With Chloropropionic Acid Covalently Bound Protein (L-2-Haloacid Dehalogenase) 5 1.7 Aspartic Acid-4-Carboxymethyl Ester • Chloride Ion CSA • PDB • PDBSum
1QQ6 Structure Of L-2-Haloacid Dehalogenase From Xanthobacter Autotrophicus With Chloroacetic Acid Covalently Bound Protein (L-2-Haloacid Dehalogenase) 5 2.1 Aspartic Acid-4-Carboxymethyl Ester • Chloride Ion CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
Nov. 3, 2014, 9:26 a.m. update curation agent sbrown setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.