Top Level Name

  ⌊ Superfamily (core) Haloacid Dehalogenase

    ⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like

  C1.5.6: HAD, Beta-PGM, Phosphatase Like

     ⌊ Family 2-haloacid dehalogenase

  ⌊ FunctionalDomain 2-haloacid dehalogenase (ID 2239)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code IES
This entry was last updated onNov. 21, 2014

References to Other Databases

Genbank

SpeciesGIAccessionModel
Xanthobacter autotrophicus 6435583 MB
Xanthobacter autotrophicus 6435582 MB

Uniprot

Protein NameAccessionEC Number IdentifierModel
(S)-2-haloacid dehalogenase Q60099 3.8.1.2 HAD_XANAU (Swiss-Prot) MB

Sequence

Length of Enzyme (full-length): 253 | Length of Functional Domain: 247

1       10        20        30        40        50        60

MIKAVVFDAYGTLFDVQSVADATERAYPGRGEYITQVWRQKQLEYSWLRALMGRYADFWS
VTREALAYTLGTLGLEPDESFLADMAQAYNRLTPYPDAAQCLAELAPLKRAILSNGAPDM
LQALVANAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGA
KNFGFSVARVARLSQEALARELVSGTIAPLTMFKALRMREETYAEAPDFVVPALGDLPRL
VRGMAGA
HLAPAV

FASTA | BLAST | HMM

This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. In many cases the functional domain is the full-length sequence. Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

This EFD conserves 6/6 Family-specific CRs and 3/5 Subgroup-specific CRs.
Position Amino Acid Family/Subgroup CAR Function Evidence Code Reference
8 Asp (D) Both Mg2+ ligand, nucleophile: attacks phosphate moiety of intermediate to form covalent intermediate ICS
147 Lys (K) Both None ICS
176 Asp (D) Both Mg2+ ligand ICS
171 Ser (S) Subgroup Mg2+ ligand ICS
172 Ser (S) Subgroup Mg2+ ligand ICS
12 Thr (T) Family None IDA
114 Ser (S) Family stabilizes COOH of intermediate ICS
153 Tyr (Y) Family None IDA

Catalyzed Reaction(s)

dehalogenation of (s)-2-haloacid

Evidence Code: IDA

EC: 3.8.1.2 | IntEnz: 3.8.1.2 | Kegg: 3.8.1.2 | BioCyc: 3.8.1.2 | BRENDA: 3.8.1.2 | MACiE: M0036 | EzCatDB: D00248

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Chimera Session Links
1QQ5 Structure Of L-2-Haloacid Dehalogenase From Xanthobacter Autotrophicus Protein (L-2-Haloacid Dehalogenase) 5 1.52 Formic Acid CSA • PDB • PDBSum
1AQ6 Structure Of L-2-Haloacid Dehalogenase From Xanthobacter Autotrophicus L-2-Haloacid Dehalogenase 5 1.95 Formic Acid CSA • PDB • PDBSum
1QQ7 Structure Of L-2-Haloacid Dehalogenase From Xanthobacter Autotrophicus With Chloropropionic Acid Covalently Bound Protein (L-2-Haloacid Dehalogenase) 5 1.7 Aspartic Acid-4-Carboxymethyl Ester • Chloride Ion CSA • PDB • PDBSum
1QQ6 Structure Of L-2-Haloacid Dehalogenase From Xanthobacter Autotrophicus With Chloroacetic Acid Covalently Bound Protein (L-2-Haloacid Dehalogenase) 5 2.1 Aspartic Acid-4-Carboxymethyl Ester • Chloride Ion CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
Nov. 3, 2014, 9:26 a.m. update curation agent sbrown setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.